Proteasome 20S alpha 3/PSMA3 Antibody

• Catalog Number: orb381091
• Category: Antibodies
• Description: Proteasome 20S alpha 3/PSMA3 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IHC, IHC-Fr, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PSMA3 (88-127aa LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human Immunocytochemistry, 0.5-1μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 28433 MW
• UniProt ID: P25788
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Proteasome subunit alpha type-3;3.4.25.1;Macropain
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of HeLa cells using anti-PSMA3 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of PSMA3 using anti-PSMA3 antibody.Lane 1:rat testis tissue;2:mouse lung tissue;3:293T cell.

IHC analysis of PSMA3 using anti-PSMA3 antibody.PSMA3 was detected in paraffin-embedded section of human intestinal cancer tissues.

IHC analysis of PSMA3 using anti-PSMA3 antibody.PSMA3 was detected in paraffin-embedded section of mouse brain tissues.

IHC analysis of PSMA3 using anti-PSMA3 antibody.PSMA3 was detected in paraffin-embedded section of rat brain tissues.