Cart summary

You have no items in your shopping cart.

    Prosurfactant Protein B/SFTPB Antibody

    Catalog Number: orb402289

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb402289
    CategoryAntibodies
    DescriptionProsurfactant Protein B/SFTPB Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence of human SFTPB (QCLAERYSVILLDTLLGRMLPQLVCRLVLR).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.1-0.5μg/ml
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW46 kDa
    UniProt IDP07988
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesPulmonary surfactant-associated protein B; SP-B; 1
    Read more...
    NoteFor research use only
    Application notesAdd 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Prosurfactant Protein B/SFTPB Antibody

    WB analysis of SFTPB using anti-SFTPB antibody.Lane 1:human MCF-7 cell;2:human COLO-320 cell;3:human HepG2 cell.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars