You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb402289 |
---|---|
Category | Antibodies |
Description | Prosurfactant Protein B/SFTPB Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human SFTPB (QCLAERYSVILLDTLLGRMLPQLVCRLVLR). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 46 kDa |
UniProt ID | P07988 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Pulmonary surfactant-associated protein B; SP-B; 1 Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of SFTPB using anti-SFTPB antibody.Lane 1:human MCF-7 cell;2:human COLO-320 cell;3:human HepG2 cell.
Filter by Rating