Cart summary

You have no items in your shopping cart.

    Prostaglandin E Receptor EP4/PTGER4 Antibody

    Catalog Number: orb19179

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb19179
    CategoryAntibodies
    DescriptionProstaglandin E Receptor EP4/PTGER4 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    ReactivityHuman
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human PTGER4 (311-345aa DLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIK), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.1-0.5μg/ml, Human
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW53119 MW
    UniProt IDP35408
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesProstaglandin E2 receptor EP4 subtype;PGE receptor
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Prostaglandin E Receptor EP4/PTGER4 Antibody

    WB analysis of PTGER4 using anti-PTGER4 antibody.Lane 1:SW620 cell;2:MCF-7 cell.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars