You have no items in your shopping cart.
Featured
Description
Research Area
Metabolism Research
Images & Validation
−| Tested Applications | ICC, IF, IHC, WB |
|---|---|
| Dilution Range | WB (1:1000) |
| Reactivity | Human, Mouse, Rat |
| Application Notes |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG2A |
| Clone No. | N319A/14 (Formerly sold as S319A-14) |
| Immunogen | Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
| Target | SUR2A |
| Molecular Weight | 120kDa |
| Purification | Protein G Purified |
| Conjugation | RPE |
Storage & Handling
−| Storage | Conjugated antibodies should be stored according to the product label |
|---|---|
| Buffer/Preservatives | 95.46mM Phosphate, 2.48mM MES and 2mM EDTA |
| Concentration | 1 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−ABCC9, Sulfonylurea receptor 2, CMD10, ABC37, ATP-binding cassette transporter sub-family C member 9, Sulfonylurea receptor 2A, isoform SUR2A

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt Details
− No UniProt data available
NCBI Gene Details
− No NCBI Gene data available
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_001038185.1 |
|---|
Protocol Information
WB
Western Blot (IB, immunoblot)
IHC
Immunohistochemistry
IF
Immunofluorescence
ICC
Immunocytochemistry

