Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SUR2A Antibody (FITC)

SKU: orb150355

Description

Mouse monoclonal to SUR2A (FITC). Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6. x (6. 1 and 6. 2). The association of four K ir6. x and four SUR subunits form an ion conducting channel commonly referred to as the K ATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir 6. x potassium channel. Hence the K ATP channel monitors the energy balance within the cell..

Research Area

Cancer Biology, Cell Biology, Disease Biomarkers, Neuroscience, Signal Transduction

Images & Validation

Tested ApplicationsICC, IF, IHC, WB
Dilution RangeWB (1:1000)
ReactivityHuman, Mouse, Rat
Application Notes
1 µg/ml was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.

Key Properties

HostMouse
ClonalityMonoclonal
IsotypeIgG2A
Clone No.N319A/14 (Formerly sold as S319A-14)
ImmunogenFusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
TargetSUR2A
Molecular Weight120kDa
PurificationProtein G Purified
ConjugationFITC

Storage & Handling

StorageConjugated antibodies should be stored according to the product label
Buffer/Preservatives640.91mM DMSO, 136.36 mM Ethanolamine, 126.89 mM chlorides, 9.09mM phosphates, 9.09mM NaHCO3
Concentration1 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ABCC9, Sulfonylurea receptor 2, CMD10, ABC37, ATP-binding cassette transporter sub-family C member 9, Sulfonylurea receptor 2A, isoform SUR2A

Similar Products

  • ABCC9 Antibody (FITC) [orb47825]

    Human

    Rabbit

    Polyclonal

    FITC

    100 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

No UniProt data available

NCBI Gene Details

No NCBI Gene data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
IF
Immunofluorescence
View Protocol
ICC
Immunocytochemistry
View Protocol

Available Sizes

Select a size below

100 μg
$ 650.00
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-3 weeks
Bulk Enquiry