REP1 Antibody

SKU: orb153343

Description

REP1 is the component A of the RAB geranylgeranyl transferase holoenzyme. In the dimeric holoenzyme, this subunit binds unprenylated Rab GTPases and then presents them to the catalytic Rab GGTase subunit for the geranylgeranyl transfer reaction. Mutations in this protein are a cause of a type of retinal degeneration, called choroideremia.

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:500-1:2,000
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 1-80 aa at the N-terminus of rat Rep1 produced in E. coli. Antigen Sequence: MADNLPSDFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGLLSWLKEYQENNDVVTENSMWQEQIL
• Target: Choroideremia (Rab escort protein 1)
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 or 500 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CHM, choroideraemia protein, DXS540, GGTA, HSD-32, RP1-93L7.1, rab escort protein 1, Rab geranylgeranyltransferase component A, REP-1, TCD antibody.

Quick Database Links

Gene Symbol

Choroideremia (Rab escort protein 1)