You have no items in your shopping cart.
Cart summary
Probable Alpha Galactosidase B Protein, Aspergillus niger, Recombinant (His)
Catalog Number: orb1979781
| Catalog Number | orb1979781 |
|---|---|
| Category | Proteins |
| Description | Hydrolyzes a variety of simple alpha-D-galactoside as well as more complex molecules such as oligosaccharides and polysaccharides. Probable Alpha Galactosidase B Protein, Aspergillus niger, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 48.7 kDa and the accession number is A2QEJ9. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 48.7 kDa (predicted) |
| UniProt ID | A2QEJ9 |
| Protein Sequence | DGVGRTPALGWNSWNAYSCDIDADKIVTAANEVVNLGLKDLGYEYINIDDCWSVKSGRNTTTKRIIPDPDKFPNGISGVADQVHALGLKLGIYSSAGLTTCAGYPASLGYEEIDAQSFAEWGIDYLKYDNCGVPTNLTDQYTYCVPDSTDGSNYPNGTCVNLTDAAPQGYDWATSTTAKRYQRMRDALLSVNRTILYSLCDWGQADVNAWGNATGNSWRMSGDITATWSRIAEIANENSFLMNYANFWGYPDPDMLEVGNGNLTLPENRAHFALWAMMKAPLIIGTPLDSIDTSHLTILSNKPLLTFHQDAVIGRPAYPYKWGYNPDWTFDPEHPAEYWSGPTSSGEVFVLMLNSEGEVKTRSAVWEEVPELKDRGTKKNSKEKKGFKVTDAWTGKDLGCVKDKYEVKLQAHDVAVLVVGGQC |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Aspergillus niger |
| Biological Activity | Hydrolyzes a variety of simple alpha-D-galactoside as well as more complex molecules such as oligosaccharides and polysaccharides. Probable Alpha Galactosidase B Protein, Aspergillus niger, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 48.7 kDa and the accession number is A2QEJ9. |
| Expression Region | 21-443 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
