PRKDC monoclonal antibody (M02), clone 1B9

• Catalog Number: orb2292342
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PRKDC.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B9
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: PRKDC (NP_008835, 4019 a.a. ~ 4128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGREPWM
• NCBI: NP_008835
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PRKDC is 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PRKDC on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to PRKDC on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]

PRKDC monoclonal antibody (M02), clone 1B9 Western Blot analysis of PRKDC expression in A-431.

Western Blot detection against Immunogen (37.84 KDa).