PRKAG3 Rabbit Polyclonal Antibody

SKU: orb331259

Description

PRKAG3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting PRKAG3. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Human. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: PRKAG3
• Protein Sequence: Synthetic peptide located within the following region: ENSSSWPSPAVTSSSERIRGKRRAKALRWTRQKSVEEGEPPGQGEGPRSR
• Molecular Weight: 54kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Anti-5 AMP activated protein kinase subunit gamma 3 antibody, anti-5''-AMP-activated protein kinase subunit gamma-3 antibody, anti-AAKG3_HUMAN antibody, anti-AMPK gamma 3 chain antibody, anti-AMPK gamma3 antibody, anti-AMPK subunit gamma-3 antibody, anti-AMPKG3 antibody, anti-PRKAG3 antibody, anti-Protein kinase AMP activated gamma 3 non catalytic subunit antibody

WB Suggested Anti-PRKAG3 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Heart.

Quick Database Links

Gene Symbol

PRKAG3

UniProt

Q9UGI9

RefSeq (Protein):NP_059127