PRKAG3 Rabbit Polyclonal Antibody

SKU: orb331259

Description

Rabbit polyclonal antibody to PRKAG3

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: PRKAG3
• Protein Sequence: Synthetic peptide located within the following region: ENSSSWPSPAVTSSSERIRGKRRAKALRWTRQKSVEEGEPPGQGEGPRSR
• Molecular Weight: 54kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Anti-5 AMP activated protein kinase subunit gamma 3 antibody, anti-5''-AMP-activated protein kinase subunit gamma-3 antibody, anti-AAKG3_HUMAN antibody, anti-AMPK gamma 3 chain antibody, anti-AMPK gamma3 antibody, anti-AMPK subunit gamma-3 antibody, anti-AMPKG3 antibody, anti-PRKAG3 antibody, anti-Protein kinase AMP activated gamma 3 non catalytic subunit antibody

WB Suggested Anti-PRKAG3 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Heart.

Quick Database Links

Gene Symbol

PRKAG3

UniProt

Q9UGI9

RefSeq (Protein):NP_059127