You have no items in your shopping cart.
Cart summary
PrgJ Protein, Salmonella typhimurium, Recombinant (Yeast, His & Myc)
Catalog Number: orb1976441
| Catalog Number | orb1976441 |
|---|---|
| Category | Proteins |
| Description | Required for invasion of epithelial cells. PrgJ Protein, Salmonella typhimurium, Recombinant (Yeast, His & Myc) is expressed in yeast with N-6xHis and C-Myc tag. The predicted molecular weight is 14.4 kDa and the accession number is P41785. |
| Tag | N-6xHis, C-Myc |
| Purity | 98.00% |
| MW | 14.4 kDa (predicted) |
| UniProt ID | P41785 |
| Protein Sequence | MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Salmonella typhimurium |
| Biological Activity | Required for invasion of epithelial cells. PrgJ Protein, Salmonella typhimurium, Recombinant (Yeast, His & Myc) is expressed in yeast with N-6xHis and C-Myc tag. The predicted molecular weight is 14.4 kDa and the accession number is P41785. |
| Expression Region | 1-101 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
