PRELP Rabbit Polyclonal Antibody

SKU: orb583148

Description

PRELP Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PRELP. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human PRELP. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Molecular Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRELP
• Target: PRELP
• Protein Sequence: Synthetic peptide located within the following region: SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH
• Molecular Weight: 42kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MST161, SLRR2A, MSTP161

Quick Database Links

Gene Symbol

PRELP

UniProt

P51888

RefSeq (Protein):NP_002716