You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291235 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant PRELID1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 7B4 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | PRELID1 (NP_037369, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | KYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLTKTNRMPRWAERLFPANVAHSVYVLEDSIVDPQNQTMTTFTWNI |
NCBI | NP_037369 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged PX19 is approximately 3 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to PX19 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]
PX19 monoclonal antibody (M01), clone 7B4 Western Blot analysis of PX19 expression in HeLa.
Western Blot detection against Immunogen (36.52 KDa).