PRELID1 monoclonal antibody (M01), clone 7B4

• Catalog Number: orb2291235
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PRELID1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 7B4
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: PRELID1 (NP_037369, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: KYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLTKTNRMPRWAERLFPANVAHSVYVLEDSIVDPQNQTMTTFTWNI
• NCBI: NP_037369
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PX19 is approximately 3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to PX19 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]

PX19 monoclonal antibody (M01), clone 7B4 Western Blot analysis of PX19 expression in HeLa.

Western Blot detection against Immunogen (36.52 KDa).