You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1979471 |
---|---|
Category | Proteins |
Description | PRDX1 Protein, Cricetulus griseus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 24.2 kDa and the accession number is Q9JKY1. |
Tag | N-6xHis |
Purity | 98.00% |
Protein Sequence | SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK |
UniProt ID | Q9JKY1 |
MW | 24.2 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | P. pastoris (Yeast) |
Biological Origin | Chinese hamster |
Biological Activity | PRDX1 Protein, Cricetulus griseus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 24.2 kDa and the accession number is Q9JKY1. |
Expression Region | 2-199 aa |
Storage | -20°C |
Note | For research use only |
98.00% | |
26.1 kDa (predicted) |