PRDM1 monoclonal antibody (M04), clone 2F8

• Catalog Number: orb2295491
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PRDM1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F8
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: PRDM1 (NP_001189, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH
• NCBI: NP_001189
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot detection against Immunogen (37.73 KDa).

Detection limit for recombinant GST tagged PRDM1 is approximately 3 ng/ml as a capture antibody.

PRDM1 monoclonal antibody (M04), clone 2F8 Western Blot analysis of PRDM1 expression in SJCRH30.

PRDM1 monoclonal antibody (M04), clone 2F8. Western Blot analysis of PRDM1 expression in human skeletal muscle.