PRDM1 monoclonal antibody (M01), clone 2B10

• Catalog Number: orb2295494
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PRDM1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2B10
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: PRDM1 (NP_001189, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH
• NCBI: NP_001189
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PRDM1 is approximately 0.3 ng/ml as a capture antibody.

PRDM1 monoclonal antibody (M01), clone 2B10. Western Blot analysis of PRDM1 expression in human spleen.

PRDM1 monoclonal antibody (M01), clone 2B10. Western Blot analysis of PRDM1 expression in human tongue.

Western Blot analysis of PRDM1 expression in transfected 293T cell line by PRDM1 monoclonal antibody (M01), clone 2B10. Lane 1: PRDM1 transfected lysate(88 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of PRDM1 over-expressed 293 cell line, cotransfected with PRDM1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PRDM1 monoclonal antibody (M01), clone 2B10 (Cat # orb2295494). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (37.73 KDa).