Prd Rabbit Polyclonal Antibody

SKU: orb325373

Description

Prd Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of prd. It is suitable for WB application. The immunogen is a synthetic peptide corresponding to a region of Fruit fly. This antibody reacts with Drosophila samples. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Drosophila

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Fruit fly
• Target: prd
• Protein Sequence: Synthetic peptide located within the following region: MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL
• Molecular Weight: 65kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti Dmel_CG6716 antibody, anti CG6716 antibody, anti Prd antibody, anti pr antibody, anti Dmel\CG6716 antibody, anti PRD antibody

Quick Database Links

Gene Symbol

prd

UniProt

P06601

RefSeq (Protein):NP_723721