You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292356 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant PPP3R1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 4E1 |
Tested applications | ELISA, IF, WB |
Reactivity | Human, Rat |
Isotype | IgG1 Kappa |
Immunogen | PPP3R1 (AAH27913, 1 a.a. ~ 170 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV |
NCBI | AAH27913 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged PPP3R1 is approximately 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to PPP3R1 on HeLa cell. [antibody concentration 25 ug/ml]
PPP3R1 monoclonal antibody (M01), clone 4E1. Western Blot analysis of PPP3R1 expression in rat brain.
Western Blot detection against Immunogen (44.44 KDa).