PPP3R1 monoclonal antibody (M01), clone 4E1

• Catalog Number: orb2292356
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant PPP3R1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4E1
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Rat
• Isotype: IgG1 Kappa
• Immunogen: PPP3R1 (AAH27913, 1 a.a. ~ 170 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
• NCBI: AAH27913
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PPP3R1 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PPP3R1 on HeLa cell. [antibody concentration 25 ug/ml]

PPP3R1 monoclonal antibody (M01), clone 4E1. Western Blot analysis of PPP3R1 expression in rat brain.

Western Blot detection against Immunogen (44.44 KDa).