PPP3CA monoclonal antibody (M03), clone 2G8

• Catalog Number: orb2292357
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PPP3CA.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2G8
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Rat
• Isotype: IgG2a Kappa
• Immunogen: PPP3CA (NP_000935, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAP
• NCBI: NP_000935
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of monoclonal antibody to PPP3CA on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to PPP3CA on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]

PPP3CA monoclonal antibody (M03), clone 2G8. Western Blot analysis of PPP3CA expression in rat brain.

Western Blot analysis of PPP3CA expression in transfected 293T cell line by PPP3CA monoclonal antibody (M03), clone 2G8. Lane 1: PPP3CA transfected lysate (Predicted MW: 57.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (34.98 KDa).