PPP1R16A purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2290728
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human PPP1R16A protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: PPP1R16A (AAH07854.1, 1 a.a. ~ 528 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTPLHAAATCGHLHLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSIEAARAVPELRMLDDIRSRLQAGADLHAPLDHGATLLHVAAANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDETPLDVCGDEEVRAKLLELKHKHDALLRAQSRQRSLLRRRTSSAGSRGKVVRRVSLTQRTDLYRKQHAQEAIVWQQPPPTSPEPPEDNDDRQTGAELRPPPPEEDNPEVVRPHNGRVGGSPVRHLYSKRLDRSVSYQLSPLDSTTPHTLVHDKAHHTLADLKRQRAAAKLQRPPPEGPESPETAEPGLPGDTVTPQPDCGFRAGGDPPLLKLTAPAVEAPVERRPCCLLM
• NCBI: AAH07854.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

PPP1R16A MaxPab polyclonal antibody. Western Blot analysis of PPP1R16A expression in human pancreas.

Western Blot analysis of PPP1R16A expression in transfected 293T cell line by PPP1R16A MaxPab polyclonal antibody. Lane 1: PPP1R16A transfected lysate(58.08 KDa). Lane 2: Non-transfected lysate.