PPIA monoclonal antibody (M01), clone 1F4-1B5

• Catalog Number: orb2292364
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant PPIA.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: PPIA (AAH00689.1, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
• Tested applications: ELISA, WB
• Clone Number: 1F4-1B5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH00689.1

Detection limit for recombinant GST tagged PPIA is approximately 0.03 ng/ml as a capture antibody.

PPIA monoclonal antibody (M01), clone 1F4-1B5 Western Blot analysis of PPIA expression in Jurkat.

Western Blot analysis of PPIA expression in transfected 293T cell line by PPIA monoclonal antibody (M01), clone 1F4-1B5. Lane 1: PPIA transfected lysate (18 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (43.89 KDa).