You have no items in your shopping cart.
Cart summary
Ppargc1a Peptide - C-terminal region
Catalog Number: orb2009456
| Catalog Number | orb2009456 |
|---|---|
| Category | Proteins |
| Description | Ppargc1a Peptide - C-terminal region |
| Tested applications | WB |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| MW | 90kDa |
| UniProt ID | O70343 |
| Protein Sequence | LENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD |
| NCBI | NP_032930 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | A830037N07Rik, PGC-1, PGC-1v, Pgc-1alpha, Pgc1, Pg Read more... |
| Note | For research use only |
| Application notes | This is a synthetic peptide designed for use in combination with Ppargc1a Rabbit Polyclonal Antibody (orb330035). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Expiration Date | 6 months from date of receipt. |
