You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292368 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant POU5F1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | POU5F1 (AAH20712, 81 a.a. ~ 164 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | WFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN |
Tested applications | ELISA, IF, WB |
Clone Number | 1B11 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH20712 |
A-549 cells were stained with POU5F1-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).
Immunofluorescence of monoclonal antibody to POU5F1 on A-549 cell. [antibody concentration 10 ug/ml]
Immunofluorescence of monoclonal antibody to POU5F1 on HeLa cell. [antibody concentration 10 ug/ml]
POU5F1 monoclonal antibody (M05), clone 1B11 Western Blot analysis of POU5F1 expression in HepG2.
Western Blot analysis of POU5F1 expression in transfected 293T cell line by POU5F1 monoclonal antibody (M05), clone 1B11. Lane 1: POU5F1 transfected lysate (18.3 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (35.24 KDa).