POU3F2 monoclonal antibody (M01), clone 6F6

• Catalog Number: orb2292370
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant POU3F2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6F6
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: POU3F2 (NP_005595, 1 a.a. ~ 67 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSH
• NCBI: NP_005595
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged POU3F2 is approximately 0.1 ng/ml as a capture antibody.

POU3F2 monoclonal antibody (M01), clone 6F6. Western Blot analysis of POU3F2 expression in Hela S3 NE.

Western Blot analysis of POU3F2 expression in transfected 293T cell line by POU3F2 monoclonal antibody (M01), clone 6F6. Lane 1: POU3F2 transfected lysate (46.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (33.11 KDa).