POLI monoclonal antibody (M01), clone 8G9

• Catalog Number: orb2291426
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant POLI.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 8G9
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG3 Kappa
• Immunogen: POLI (AAH32662, 616 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PQGFHFTNSNPAVSAFHSFPNLQSEQLFSRNHTTDSHKQTVATDSHEGLTENREPDSVDEKITFPSDIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK
• NCBI: AAH32662
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged POLI is approximately 0.1 ng/ml as a capture antibody.

POLI monoclonal antibody (M01), clone 8G9. Western Blot analysis of POLI expression in U-2 OS.

Western Blot analysis of POLI expression in transfected 293T cell line by POLI monoclonal antibody (M01), clone 8G9. Lane 1: POLI transfected lysate(80.3 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).