PNPO polyclonal antibody (A01)

• Catalog Number: orb2291051
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a partial recombinant PNPO.
• Clonality: Polyclonal
• Species/Host: Mouse
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: 50 % glycerol
• Immunogen: PNPO (NP_060599, 163 a.a. ~ 261 a.a) partial recombinant protein with GST tag.
• Protein Sequence: KSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP
• Tested applications: ELISA, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_060599
• Expiration Date: 12 months from date of receipt.

PNPO polyclonal antibody (A01), Western Blot analysis of PNPO expression in MES-SA/Dx5.

Western Blot detection against Immunogen (37 KDa).