PML monoclonal antibody (M02), clone 1D12

• Catalog Number: orb2292380
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PML.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: PML (AAH00080, 411 a.a. ~ 510 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV
• Tested applications: ELISA, IF, PLA, WB
• Clone Number: 1D12
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH00080

Detection limit for recombinant GST tagged PML is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PML on HeLa cell. [antibody concentration 10 ug/ml]

PML monoclonal antibody (M02), clone 1D12 Western Blot analysis of PML expression in Hela S3 NE.

PML monoclonal antibody (M02), clone 1D12. Western Blot analysis of PML expression in PC-12.

Proximity Ligation Analysis of protein-protein interactions between TP53 and PML. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-PML mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.63 KDa).