You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292388 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant PLD2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1C5 |
Tested applications | ELISA, WB |
Reactivity | Human, Rat |
Isotype | IgG2a Kappa |
Immunogen | PLD2 (AAH15033, 834 a.a. ~ 933 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | LRDPICDDFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQGHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT |
NCBI | AAH15033 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged PLD2 is approximately 0.03 ng/ml as a capture antibody.
PLD2 monoclonal antibody (M01), clone 1C5. Western Blot analysis of PLD2 expression in rat brain.
Western Blot analysis of PLD2 expression in transfected 293T cell line by PLD2 monoclonal antibody (M01), clone 1C5. Lane 1: PLD2 transfected lysate (Predicted MW: 105.9 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.74 KDa).