PLD1 monoclonal antibody (M01), clone 2F3

• Catalog Number: orb2292390
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PLD1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: PLD1 (NP_002653, 965 a.a. ~ 1074 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
• Tested applications: ELISA, WB
• Clone Number: 2F3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_002653

Detection limit for recombinant GST tagged PLD1 is 0.03 ng/ml as a capture antibody.

Western Blot analysis of PLD1 expression in transfected 293T cell line by PLD1 monoclonal antibody (M01), clone 2F3. Lane 1: PLD1 transfected lysate (124.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).