You have no items in your shopping cart.
Cart summary
PLA2G12A Recombinant Protein (Human)
Catalog Number: orb2053449
| Catalog Number | orb2053449 |
|---|---|
| Category | Proteins |
| Description | PLA2G12A Recombinant Protein (Human) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 20.3 kDa |
| UniProt ID | Q9BZM1 |
| Protein Sequence | QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEE |
| Source | Yeast |
| NCBI | NP_110448 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | group XII secreted phospholipase A2;group XIIA sec Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human PLA2G12A protein [orb595128]
Greater than 85% as determined by SDS-PAGE.
22.6 kDa
Baculovirus
20 μg, 100 μg, 500 μg, 1 mgHuman PLA2G12A protein [orb605110]
Greater than 85% as determined by SDS-PAGE.
26.2 kDa
E.coli
100 μg, 20 μg, 1 mgHuman PLA2G12A protein [orb246190]
Greater than 90% as determined by SDS-PAGE.
20.3 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mgPLA2G12A Recombinant Protein (Human) [orb2053447]
Greater than 90% as determined by SDS-PAGE.
20.3 kDa
Yeast
500 μgPLA2G12A Recombinant Protein (Human) [orb2053448]
Greater than 90% as determined by SDS-PAGE.
20.3 kDa
Yeast
20 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
