PKD2 Antibody (Phospho-Ser876)

• Catalog Number: orb2240588
• Category: Antibodies
• Description: PKD2 Antibody (Phospho-Ser876)
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, IF, IHC, IHC-P, WB
• Immunogen: The antiserum was produced against synthesized peptide derived from human PKD2 around the phosphorylation site of Ser876.
• Conjugation: Unconjugated
• MW: 96 kDa
• UniProt ID: Q9BZL6
• Protein Sequence: Synthetic peptide located within the following region: THESDDVRWEQFAAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL
• Storage: -20°C
• Alternative names: HSPC187;nPKC-D2;PKD2;serine/threonine-protein kina
• Note: For research use only
• Application notes: Application Info: WB: 1:500~1:1000ELISA: 1:60000
• Expiration Date: 12 months from date of receipt.