Cart summary

You have no items in your shopping cart.

    PKD1/2/3/PKC mu Antibody (Phospho-Ser738+Ser742) : Biotin

    PKD1/2/3/PKC mu Antibody (Phospho-Ser738+Ser742) : Biotin

    Catalog Number: orb2071417

    DispatchUsually dispatched within 5-10 working days
    $ 578.00
    Catalog Numberorb2071417
    CategoryAntibodies
    DescriptionPKD1/2/3/PKC mu Antibody (Phospho-Ser738+Ser742) : Biotin
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsELISA, IHC, WB
    ImmunogenThe antiserum was produced against synthesized peptide derived from human PKD1/2/3/PKC mu around the phosphorylation site of Ser738 and Ser742.
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
    ConjugationBiotin
    MW101 kDa
    UniProt IDO94806, Q15139, Q9BZL6
    Protein SequenceSynthetic peptide located within the following region: DLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVL
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
    Alternative namesPKD, PKCM, CHDED, PRKCM, PKC-MU
    Read more...
    NoteFor research use only
    Application notesApplication Info: WB: 1:500~1:1000IHC: 1:50~1:100ELISA: 1:5000
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars