PKC gamma/PRKCG Antibody

• Catalog Number: orb527004
• Category: Antibodies
• Description: PKC gamma/PRKCG Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human PKC gamma/PRKCG (DRLVLASIDQADFQGFTYVNPDFVHPDARS).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 5μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 78 kDa
• UniProt ID: P05129
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Protein kinase C gamma type; PKC-gamma; PRKCG; PKC
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

IF analysis of rat celebellum tissue using PKC gamma antibody.

WB analysis of PKC gamma using anti-PKC gamma antibody.Lane 1:human U87 cell; 2:rat brain tissue; 3:mouse brain tissue; 4:rat kidney tissue; 5:mouse kidney tissue.

IF analysis of PKC gamma using anti-PKC gamma antibody. PKC gamma was detected in an immunocytochemical section of SH-SY5Y cells.

IF analysis of PKC gamma using anti-PKC gamma antibody. PKC gamma was detected in a paraffin-embedded section of rat celebellum tissue.

IHC analysis of PKC gamma using anti-PKC gamma antibody.PKC gamma was detected in paraffin-embedded section of human glioma tissues.

IHC analysis of PKC gamma using anti-PKC gamma antibody.PKC gamma was detected in paraffin-embedded section of mouse brain tissues.

IHC analysis of PKC gamma using anti-PKC gamma antibody.PKC gamma was detected in paraffin-embedded section of rat brain tissues.

IHC analysis of PKC gamma using anti-PKC gamma antibody.PKC gamma was detected in paraffin-embedded section of mouse brain tissues.

IHC analysis of PKC gamma using anti-PKC gamma antibody. PKC gamma was detected in a paraffin-embedded section of mouse brain tissue.

IHC analysis of PKC gamma using anti-PKC gamma antibody. PKC gamma was detected in a paraffin-embedded section of mouse cerebellum tissue.

IHC analysis of PKC gamma using anti-PKC gamma antibody. PKC gamma was detected in a paraffin-embedded section of rat brain tissue.