PITX2/RGS Antibody

• Catalog Number: orb570403
• Category: Antibodies
• Description: PITX2/RGS Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, WB
• Reactivity: Mouse
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human PITX2/RGS (METNCRKLVSACVQLGVQPAAVECLFSKDSEIKK).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.25-0.5μg/ml, Human, Mouse Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 35 kDa
• UniProt ID: Q99697
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Pituitary homeobox 2; ALL1-responsive protein ARP1
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of 293T cells using anti-PITX2 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.

WB analysis using anti-PITX2 antibody.Lane 1:Caco-2 cell, Lane 2:HEK293 cell, Lane 3:U2OS cell, Lane 4:HeLa cell, Lane 5:A549 cell, Lane 6:U-87MG cell, Lane 7:rat heart tissue, Lane 8:mouse RAW246.7 cell.