PITX1 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2292400
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human PITX1 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Reactivity: Human, Mouse
• Immunogen: PITX1 (NP_002644.3, 1 a.a. ~ 314 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGALQGPASGLNACQYNS
• NCBI: NP_002644.3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of purified MaxPab antibody to PITX1 on HeLa cell. [antibody concentration 10 ug/ml]

PITX1 MaxPab rabbit polyclonal antibody. Western Blot analysis of PITX1 expression in human placenta.

PITX1 MaxPab rabbit polyclonal antibody. Western Blot analysis of PITX1 expression in mouse brain.

Western Blot analysis of PITX1 expression in transfected 293T cell line by PITX1 MaxPab polyclonal antibody. Lane 1: PITX1 transfected lysate (34.10 KDa). Lane 2: Non-transfected lysate.