PITX1 monoclonal antibody (M02), clone 6D4

• Catalog Number: orb2292398
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PITX1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: PITX1 (NP_002644, 225 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN
• Tested applications: ELISA, WB
• Clone Number: 6D4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_002644

Detection limit for recombinant GST tagged PITX1 is approximately 0.03 ng/ml as a capture antibody.

PITX1 monoclonal antibody (M02), clone 6D4 Western Blot analysis of PITX1 expression in A-431.

Western Blot detection against Immunogen (35.53 KDa).