PITX1 monoclonal antibody (M01), clone 5G4

• Catalog Number: orb2292399
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PITX1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5G4
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: PITX1 (NP_002644, 225 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN
• NCBI: NP_002644
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PITX1 is approximately 0.03 ng/ml as a capture antibody.

Immunoprecipitation of PITX1 transfected lysate using anti-PITX1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PITX1 MaxPab rabbit polyclonal antibody.

PITX1 monoclonal antibody (M01), clone 5G4 Western Blot analysis of PITX1 expression in Hela S3 NE.

Western Blot analysis of PITX1 expression in transfected 293T cell line by PITX1 monoclonal antibody (M01), clone 5G4. Lane 1: PITX1 transfected lysate (34.1 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of PITX1 over-expressed 293 cell line, cotransfected with PITX1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PITX1 monoclonal antibody (M01), clone 5G4 (Cat # orb2292399). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (35.53 KDa).