PIPOX monoclonal antibody (M10), clone 3D1

• Catalog Number: orb2291148
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PIPOX.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D1
• Tested applications: ELISA, IF, IP, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: PIPOX (AAH27622.1, 292 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: IGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKILYELSMKLTPSYDLAPFRISRFPG
• NCBI: AAH27622.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of monoclonal antibody to PIPOX on HeLa cell. [antibody concentration 10 ug/ml]

Immunoprecipitation of PIPOX transfected lysate using anti-PIPOX monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PIPOX MaxPab rabbit polyclonal antibody.

Western Blot analysis of PIPOX expression in transfected 293T cell line by PIPOX monoclonal antibody (M10), clone 3D1. Lane 1: PIPOX transfected lysate(44.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.64 KDa).