You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291148 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant PIPOX. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3D1 |
Tested applications | ELISA, IF, IP, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | PIPOX (AAH27622.1, 292 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | IGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKILYELSMKLTPSYDLAPFRISRFPG |
NCBI | AAH27622.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunofluorescence of monoclonal antibody to PIPOX on HeLa cell. [antibody concentration 10 ug/ml]
Immunoprecipitation of PIPOX transfected lysate using anti-PIPOX monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PIPOX MaxPab rabbit polyclonal antibody.
Western Blot analysis of PIPOX expression in transfected 293T cell line by PIPOX monoclonal antibody (M10), clone 3D1. Lane 1: PIPOX transfected lysate(44.1 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (35.64 KDa).