PIK3R4 monoclonal antibody (M02), clone 1B5

• Catalog Number: orb2291188
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PIK3R4.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B5
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: PIK3R4 (NP_055417, 1259 a.a. ~ 1358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
• NCBI: NP_055417
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PIK3R4 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PIK3R4 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to PIK3R4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.6 ug/ml]

PIK3R4 monoclonal antibody (M02), clone 1B5 Western Blot analysis of PIK3R4 expression in HeLa.

Western Blot detection against Immunogen (36.74 KDa).