PIK3R4 monoclonal antibody (M03), clone 1G12

• Catalog Number: orb2291187
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PIK3R4.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1G12
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: PIK3R4 (NP_055417, 1259 a.a. ~ 1358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
• NCBI: NP_055417
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PIK3R4 is approximately 0.03 ng/ml as a capture antibody.

PIK3R4 monoclonal antibody (M03), clone 1G12 Western Blot analysis of PIK3R4 expression in HeLa.

Western Blot analysis of PIK3R4 expression in transfected 293T cell line by PIK3R4 monoclonal antibody (M03), clone 1G12. Lane 1: PIK3R4 transfected lysate(153.103 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).