Pi4k2b Rabbit Polyclonal Antibody

• Catalog Number: orb326160
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Pi4k2b
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 52kDa
• Target: Pi4k2b
• UniProt ID: Q8CBQ5
• Protein Sequence: Synthetic peptide located within the following region: EDPEFADIVLKAEQAIEIGVFPERISQGSSGSYFVKDSKRNIIGVFKPKS
• NCBI: NP_080227
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti 2610042N09Rik antibody, anti 4933409G22Rik an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Pi4k2b Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Liver.