PI3 Kinase p110 beta/PIK3CB Antibody

• Catalog Number: orb19160
• Category: Antibodies
• Description: PI3 Kinase p110 beta/PIK3CB Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PIK3CB (556-598aa DLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIW), different from the related mouse and rat sequences by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 122762 MW
• UniProt ID: P42338
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Phosphatidylinositol 4,5-bisphosphate 3-kinase cat
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of PIK3CB using anti-PIK3CB antibody.Lane 1:rat liver tissue;2:rat kidney tissue;3:mouse spleen tissue;4:mouse thymus tissue;5:MCF-7 cell;6:K562 cell.

IHC analysis of PIK3CB using anti-PIK3CB antibody. PIK3CB was detected in paraffin-embedded section of human intestinal cancer tissues.

IHC analysis of PIK3CB using anti-PIK3CB antibody. PIK3CB was detected in paraffin-embedded section of human lung cancer tissues.