You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295836 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant PHOX2A. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | PHOX2A (NP_005160, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQ |
Tested applications | ELISA, IF, WB |
Clone Number | 4F6 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_005160 |
Immunofluorescence of monoclonal antibody to PHOX2A on HeLa cell. [antibody concentration 10 ug/ml].
PHOX2A monoclonal antibody (M01), clone 4F6 Western Blot analysis of PHOX2A expression in PC-12.
Western Blot analysis of PHOX2A expression in transfected 293T cell line by PHOX2A monoclonal antibody (M01), clone 4F6. Lane 1: PHOX2A transfected lysate(29.7 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of PHOX2A over-expressed 293 cell line, cotransfected with PHOX2A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PHOX2A monoclonal antibody (M01), clone 4F6 (Cat # orb2295836). GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (35.64 KDa).