PHOX2A monoclonal antibody (M01), clone 4F6

• Catalog Number: orb2295836
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PHOX2A.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: PHOX2A (NP_005160, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQ
• Tested applications: ELISA, IF, WB
• Clone Number: 4F6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_005160

Immunofluorescence of monoclonal antibody to PHOX2A on HeLa cell. [antibody concentration 10 ug/ml].

PHOX2A monoclonal antibody (M01), clone 4F6 Western Blot analysis of PHOX2A expression in PC-12.

Western Blot analysis of PHOX2A expression in transfected 293T cell line by PHOX2A monoclonal antibody (M01), clone 4F6. Lane 1: PHOX2A transfected lysate(29.7 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of PHOX2A over-expressed 293 cell line, cotransfected with PHOX2A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PHOX2A monoclonal antibody (M01), clone 4F6 (Cat # orb2295836). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (35.64 KDa).