Phospholamban/PLN Antibody

• Catalog Number: orb251564
• Category: Antibodies
• Description: Phospholamban/PLN Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PLN (1-35aa MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINF), different from the related mouse and rat sequences by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5 μg/ml, Mouse, Rat Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Mouse, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 6109 MW
• UniProt ID: P26678
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Cardiac phospholamban;PLB;PLN;PLB;
• Note: For research use only
• Application notes: WB: The detection limit for PLN is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of PLN using anti-PLN antibody.Lane 1:rat heart tissue; 2:rat heart tissue; 3:mouse heart tissue; 4:mouse heart tissue.

IHC analysis of PLN using anti-PLN antibody. PLN was detected in a paraffin-embedded section of mouse cardiac muscle tissue.

IHC analysis of PLN using anti-PLN antibody. PLN was detected in a paraffin-embedded section of rat cardiac muscle tissue.