You have no items in your shopping cart.
Cart summary
Phosphinothricin N-acetyltransferase Protein, S. viridochromogenes, Recombinant (His & SUMO)
Catalog Number: orb1976312
| Catalog Number | orb1976312 |
|---|---|
| Category | Proteins |
| Description | Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance. Phosphinothricin N-acetyltransferase Protein, S. viridochromogenes, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 36.6 kDa and the accession number is Q57146. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| MW | 36.6 kDa (predicted) |
| UniProt ID | Q57146 |
| Protein Sequence | MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI |
| Expression System | E. coli |
| Biological Origin | Streptomyces viridochromogenes |
| Biological Activity | Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance. Phosphinothricin N-acetyltransferase Protein, S. viridochromogenes, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 36.6 kDa and the accession number is Q57146. |
| Expression Region | 1-183 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
