PHKA1 Rabbit Polyclonal Antibody

• Catalog Number: orb588420
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PHKA1
• Target: PHKA1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen for Anti-PHKA1 antibody is: synthetic peptide directed towards the C-terminal of Human KPB1
• Protein Sequence: Synthetic peptide located within the following region: KQSPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFY
• UniProt ID: P46020
• MW: 126 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PHKA
• Research Area: Protein Biochemistry
• Note: For research use only

Sample Type: 293T Whole Cell, Antibody Dilution: 1.0 ug/ml.