PHF1 monoclonal antibody (M01), clone 2D3

• Catalog Number: orb2292409
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PHF1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2D3
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: PHF1 (NP_077084, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP
• NCBI: NP_077084
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

PHF1 monoclonal antibody (M01), clone 2D3 Western Blot analysis of PHF1 expression in A-431.

Western Blot detection against Immunogen (36.63 KDa).