PHC1 monoclonal antibody (M05), clone 3G1

• Catalog Number: orb2293345
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PHC1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3G1
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: PHC1 (NP_004417, 751 a.a. ~ 851 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PVGCSQLLKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEANY*
• NCBI: NP_004417
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PHC1 is approximately 3 ng/ml as a capture antibody.

PHC1 monoclonal antibody (M05), clone 3G1. Western Blot analysis of PHC1 expression in MCF-7.

Western Blot detection against Immunogen (37.11 KDa).