You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292410 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant PHB. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3F4-2B2 |
Tested applications | ELISA, IF, IHC-P, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2a kappa |
Immunogen | PHB (AAH13401, 1 a.a. ~ 272 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ |
NCBI | AAH13401 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged PHB is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to PHB on HeLa cell. [antibody concentration 1 ~ 10 ug/ml]
Immunoperoxidase of monoclonal antibody to PHB on formalin-fixed paraffin-embedded human colon adenocarcinoma. [antibody concentration 5 ug/ml]
Immunoperoxidase of monoclonal antibody to PHB on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 5 ug/ml]
PHB monoclonal antibody (M01), clone 3F4-2B2 Western Blot analysis of PHB expression in Hela.
PHB monoclonal antibody (M01), clone 3F4-2B2. Western Blot analysis of PHB expression in NIH/3T3.
PHB monoclonal antibody (M01), clone 3F4-2B2. Western Blot analysis of PHB expression in PC-12.
Western Blot detection against Immunogen (55.66 KDa).