PGRMC2 monoclonal antibody (M04), clone 3C11

• Catalog Number: orb2291573
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PGRMC2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3C11
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG1 Kappa
• Immunogen: PGRMC2 (NP_006311, 124 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: NGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD
• NCBI: NP_006311
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PGRMC2 is approximately 0.3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to PGRMC2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1 ug/ml]

PGRMC2 monoclonal antibody (M04), clone 3C11. Western Blot analysis of PGRMC2 expression in PC-12.

Western Blot detection against Immunogen (36.74 KDa).