You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292421 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant PFKFB3. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | PFKFB3 (NP_004557, 412 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | CPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH |
Tested applications | ELISA, IP, WB |
Clone Number | 3F3 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_004557 |
Detection limit for recombinant GST tagged PFKFB3 is approximately 3 ng/ml as a capture antibody.
Immunoprecipitation of PFKFB3 transfected lysate using anti-PFKFB3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PFKFB3 MaxPab rabbit polyclonal antibody.
Western Blot analysis of PFKFB3 expression in transfected 293T cell line by PFKFB3 monoclonal antibody (M08), clone 3F3. Lane 1: PFKFB3 transfected lysate (59.6 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (37.73 KDa).